Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501483 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-NFKB Repressing Factor (NKRF) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NKRF antibody: synthetic peptide directed towards the N terminal of human NKRF
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
HFVASSSKDERQEDPYGPQTKEVNEQTHFASMPRD
IYQDY TQDSFSIQDG- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references NRF IRES activity is mediated by RNA binding protein JKTBP1 and a 14-nt RNA element.
Reboll MR, Oumard A, Gazdag AC, Renger I, Ritter B, Schwarzer M, Hauser H, Wood M, Yamada M, Resch K, Nourbakhsh M
RNA (New York, N.Y.) 2007 Aug;13(8):1328-40
RNA (New York, N.Y.) 2007 Aug;13(8):1328-40
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting