HPA001476

NKRF antibody from Sigma-Aldrich
ITBA4, NRF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001476
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001476, RRID:AB_1079488
Product name
Anti-NKRF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001476
Antibody type
Polyclonal
Antigen
NF-kappa-B-repressing factor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLNDTAQFNRMTVEYVYERMTGLRWKCKVILESEV
IAEAVGVKKTVKYEAAGEAVKTLKKTQPTVINNLK
KGAVEDVISRNEIQGRSAEEAYKQQIKEDNIGNQL
LRKMGWTGGGLGKSGEGIREPISVKEQHKREGLGL
DVE
Storage
-20C
Provider Type Product Number
- No reagents -