Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109576 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 320 (ZNF320) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the N-terminal region of human ZNF320
- Description
- Immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
NDHEAPMTEIKKLTSSTDRYDQRHAGNKPIKGQLE
SRFHLHLRRHRRIHT- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human MCF-7; WB Suggested Anti-ZNF320 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: MCF7 cell lysate; ZNF320 antibody - N-terminal region (AP46083PU-N) in Human MCF-7 cells using Western Blot