HPA001648

DDX3X antibody from Atlas Antibodies
DBX, DDX14, DDX3, HLP2

Antibody data

Product number
HPA001648
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001648, RRID:AB_1078635
Product name
Anti-DDX3X
Provider product page
Atlas Antibodies - HPA001648
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDK
DSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGS
GSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNS
RWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINF
EKYDDIPV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.