HPA001648
DDX3X antibody from Atlas Antibodies
DBX, DDX14, DDX3, HLP2
- Western blot
Supportive data in Antibodypedia
- Immunocytochemistry
Supportive data in Antibodypedia
- Immunohistochemistry
Supportive data in Antibodypedia
Antibody data
- Antibody Data
- References [3]
- Comments [0]
- Validations
- Western blot [6]
- Immunocytochemistry [1]
- Immunohistochemistry [19]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001648
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001648, RRID:AB_1078635
- Product name
- Anti-DDX3X
- Provider product page
- Atlas Antibodies - HPA001648
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDK
DSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGS
GSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNS
RWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINF
EKYDDIPV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Systematic Interrogation of 3q26 Identifies TLOC1 and SKIL as Cancer Drivers
Hagerstrand D, Tong A, Schumacher S, Ilic N, Shen R, Cheung H, Vazquez F, Shrestha Y, Kim S, Giacomelli A, Rosenbluh J, Schinzel A, Spardy N, Barbie D, Mermel C, Weir B, Garraway L, Tamayo P, Mesirov J, Beroukhim R, Hahn W
Cancer Discovery 2013 September;3(9):1044-1057
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E
Journal of Proteomics 2012 April;75(7):2236-2251
Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics
Mulder J, Bjorling E, Jonasson K, Wernerus H, Hober S, Hokfelt T, Uhlen M
Molecular & Cellular Proteomics 2009 July;8(7):1612-1622
Hagerstrand D, Tong A, Schumacher S, Ilic N, Shen R, Cheung H, Vazquez F, Shrestha Y, Kim S, Giacomelli A, Rosenbluh J, Schinzel A, Spardy N, Barbie D, Mermel C, Weir B, Garraway L, Tamayo P, Mesirov J, Beroukhim R, Hahn W
Cancer Discovery 2013 September;3(9):1044-1057
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E
Journal of Proteomics 2012 April;75(7):2236-2251
Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics
Mulder J, Bjorling E, Jonasson K, Wernerus H, Hober S, Hokfelt T, Uhlen M
Molecular & Cellular Proteomics 2009 July;8(7):1612-1622
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human cell line A-431Lane 5: Human liver tissueLane 6: Human tonsil tissue
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line SiHa.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-DDX3X antibody HPA001648 (A) shows similar pattern to independent antibody HPA005631 (B).
- Sample type
- HUMAN
- Antibody #2 product nr
- HPA005631
- Antibody provider
- Atlas Antibodies
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human appendix shows strong cytoplasmic positivity in reaction center cells in lymphoid tissue.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse medulla shows strong cytoplasmic immunoreactivity in neurons of the facial nucleus.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows moderate positivity in neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse thalamus shows positivity in neurons of the anterodorsal thalamic nucleus.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse hippocampus shows cytoplasmic immunoreactivity in a subset of neurons in the CA2/CA3 areas.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse parietal association cortex shows strong cytoplasmic positivity in neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse midbrain shows neuronal positivity in the red nucleus.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate nuclear immunoreactivity in neuronal cell bodies.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows moderate nuclear immunoreactivity in neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows moderate positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human Fallopian tube shows weak cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse hippocampus shows moderate positivity in a subset of neurons in the brain.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse midbrain shows moderate neuronal positivity in the red nucleus.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse cerebral cortex shows strong positivity in neurons in the parietal association cortex.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse thalamus shows moderate positivity in neurons of the anterodorsal thalamic nucleus.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse medulla shows strong positivity in neurons of the facial nucleus.
- Sample type
- MOUSE