HPA005631

DDX3X antibody from Atlas Antibodies
DBX, DDX14, DDX3, HLP2
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA005631
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005631, RRID:AB_1078633
Product name
Anti-DDX3X
Provider product page
Atlas Antibodies - HPA005631
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINI
TKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGR
SKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSR
SGGGGHGSSRGFGGGGYGG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -