HPA001648

DDX3X antibody from Sigma-Aldrich
DBX, DDX14, DDX3, HLP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001648
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001648, RRID:AB_1078635
Product name
Anti-DDX3X antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001648
Antibody type
Polyclonal
Antigen
ATP-dependent RNA helicase DDX3Y recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDK
DSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGS
GSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNS
RWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINF
EKYDDIPV
Storage
-20C
Provider Type Product Number
- No reagents -