Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503439 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Phosphoseryl-tRNA Kinase (PSTK) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PSTK antibody: synthetic peptide directed towards the middle region of human PSTK
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQL
FLDCP LETCLQRNGQ- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification and characterization of phosphoseryl-tRNA[Ser]Sec kinase.
Carlson BA, Xu XM, Kryukov GV, Rao M, Berry MJ, Gladyshev VN, Hatfield DL
Proceedings of the National Academy of Sciences of the United States of America 2004 Aug 31;101(35):12848-53
Proceedings of the National Academy of Sciences of the United States of America 2004 Aug 31;101(35):12848-53
No comments: Submit comment
No validations: Submit validation data