HPA001882

UPF3B antibody from Sigma-Aldrich
HUPF3B, MRX62, RENT3B, UPF3X
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001882
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001882, RRID:AB_1080474
Product name
Anti-UPF3B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001882
Antibody type
Polyclonal
Antigen
Regulator of nonsense transcripts 3B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKG
EDKQDRNKEKKEALSKVVIRRLPPTLTKEQLQEHL
QPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQED
IILFRDRFDGYVFLDNKGQEYPAIVE
Storage
-20C
Provider Type Product Number
- No reagents -