H00023157-M01

SEPTIN6 antibody from Abnova Corporation
KIAA0128, MGC16619, MGC20339, SEP2, SEPT2, SEPT6

Antibody data

Product number
H00023157-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023157-M01, RRID:AB_1713655
Product name
SEPT6 monoclonal antibody (M01), clone 1D6
Provider product page
Abnova Corporation - H00023157-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SEPT6.
Antigen sequence
MAATDIARQVGEGCRTVPLAGHVGFDSLPDQLVNK
SVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGE
PATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGF
GDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVL
HTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDS
KVNIIPIIAKADAISKSELTKFKIKITSELVSNGV
QIYQFPTDDESVAEINGTMNAHLPFAVIGSTEELK
IGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIR
VNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDS
KPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV
KEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDK
KKSLDDEVNAFKQRKTAAELPQSQGSQAGGSQTLK
RDKEKKNNPWLCTE
Isotype
IgG
Antibody clone number
1D6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -