Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184070 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear RNA Export Factor 5 (NXF5) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NXF5 antibody: synthetic peptide directed towards the middle region of human NXF5
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKV
KTLNL SKNKLESAWE- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Inv(X)(p21.1;q22.1) in a man with mental retardation, short stature, general muscle wasting, and facial dysmorphism: clinical study and mutation analysis of the NXF5 gene.
Frints SG, Jun L, Fryns JP, Devriendt K, Teulingkx R, Van den Berghe L, De Vos B, Borghgraef M, Chelly J, Des Portes V, Van Bokhoven H, Hamel B, Ropers HH, Kalscheuer V, Raynaud M, Moraine C, Marynen P, Froyen G
American journal of medical genetics. Part A 2003 Jun 15;119A(3):367-74
American journal of medical genetics. Part A 2003 Jun 15;119A(3):367-74
No comments: Submit comment
No validations: Submit validation data