HPA002079

NXF5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002079
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002079, RRID:AB_1079515
Product name
Anti-NXF5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002079
Antibody type
Polyclonal
Antigen
Nuclear RNA export factor 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQALDL
QNLRFDPDLMGRDIDIILNRRNCMAATLKITERNF
PELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLS
KNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQ
S
Storage
-20C
Provider Type Product Number
- No reagents -