Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002809 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002809, RRID:AB_1078855
- Product name
- Anti-FGF13
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
STYTLFNLIPVGLRVVAIQGVQTKLYLAMNSEGYL
YTSELFTPECKFKESVFENYYVTYSSMIYRQQQSG
RGWYLGLNKEGEIMKGNHVKKNKPAAHFLPKPLKV
AMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGG
KSMSHNES- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references FGF13 Is Required for Histamine-Induced Itch Sensation by Interaction with NaV1.7
Fhf2 gene deletion causes temperature-sensitive cardiac conduction failure
Disruption of Fgf13 Causes Synaptic Excitatory-Inhibitory Imbalance and Genetic Epilepsy and Febrile Seizures Plus
Dong F, Shi H, Yang L, Xue H, Wei M, Zhong Y, Bao L, Zhang X
The Journal of Neuroscience 2020;40(50):9589-9601
The Journal of Neuroscience 2020;40(50):9589-9601
Fhf2 gene deletion causes temperature-sensitive cardiac conduction failure
Park D, Shekhar A, Marra C, Lin X, Vasquez C, Solinas S, Kelley K, Morley G, Goldfarb M, Fishman G
Nature Communications 2016;7(1)
Nature Communications 2016;7(1)
Disruption of Fgf13 Causes Synaptic Excitatory-Inhibitory Imbalance and Genetic Epilepsy and Febrile Seizures Plus
Puranam R, He X, Yao L, Le T, Jang W, Rehder C, Lewis D, McNamara J
Journal of Neuroscience 2015;35(23):8866-8881
Journal of Neuroscience 2015;35(23):8866-8881
No comments: Submit comment
No validations: Submit validation data