HPA002809

FGF13 antibody from Sigma-Aldrich
FGF2, FHF2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002809
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002809, RRID:AB_1078855
Product name
Anti-FGF13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002809
Antibody type
Polyclonal
Antigen
Fibroblast growth factor 13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STYTLFNLIPVGLRVVAIQGVQTKLYLAMNSEGYL
YTSELFTPECKFKESVFENYYVTYSSMIYRQQQSG
RGWYLGLNKEGEIMKGNHVKKNKPAAHFLPKPLKV
AMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGG
KSMSHNES
Storage
-20C
Provider Type Product Number
- No reagents -