Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006018-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006018-M05, RRID:AB_10962827
- Product name
- RLF monoclonal antibody (M05), clone 2G2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RLF.
- Antigen sequence
SNDLTGNVVANNMVNDSEPEVDIPHSSSDSTIHEN
LTAIPPLIVAETTTVPSLENLRVVLDKALTDCGEL
ALKQLHYLRPVVVLERSKFSTPILDLFPTKKTDEL
CVGS- Isotype
- IgG
- Antibody clone number
- 2G2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references An ENU mutagenesis screen identifies novel and known genes involved in epigenetic processes in the mouse.
Daxinger L, Harten SK, Oey H, Epp T, Isbel L, Huang E, Whitelaw N, Apedaile A, Sorolla A, Yong J, Bharti V, Sutton J, Ashe A, Pang Z, Wallace N, Gerhardt DJ, Blewitt ME, Jeddeloh JA, Whitelaw E
Genome biology 2013;14(9):R96
Genome biology 2013;14(9):R96
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RLF is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol