HPA001651

NLGN4X antibody from Sigma-Aldrich
HLNX, KIAA1260, NLGN, NLGN4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001651
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001651, RRID:AB_1079470
Product name
Anti-NLGN4X antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001651
Antibody type
Polyclonal
Antigen
Neuroligin-4, X-linked precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QYPVVNTNYGKIRGLRTPLPNEILGPVEQYLGVPY
ASPPTGERRFQPPEPPSSWTGIRNTTQFAAVCPQH
LDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLY
LNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGN
MIDGS
Storage
-20C
Provider Type Product Number
- No reagents -