Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA045816 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-SNX27
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LSVPPHEADNLDPSDDSLGQSFYDYTEKQAVPISV
PRYKHVEQNGEKFVVYNVYMAGRQLCSKRYREFAI
LHQNLK- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references SNX27-Mediated Recycling of Neuroligin-2 Regulates Inhibitory Signaling.
Halff EF, Szulc BR, Lesept F, Kittler JT
Cell reports 2019 Nov 26;29(9):2599-2607.e6
Cell reports 2019 Nov 26;29(9):2599-2607.e6
No comments: Submit comment
No validations: Submit validation data