HPA000867

EIF5 antibody from Atlas Antibodies
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA000867
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000867, RRID:AB_611452
Product name
Anti-EIF5
Provider product page
Atlas Antibodies - HPA000867
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTV
IVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVK
NDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENP
ETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTF
ILKNPPENSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -