HPA000867

EIF5 antibody from Atlas Antibodies
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA000867
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000867, RRID:AB_1078731
Product name
Anti-EIF5
Provider product page
Atlas Antibodies - HPA000867
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTV
IVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVK
NDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENP
ETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTF
ILKNPPENSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -