HPA000867

EIF5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000867
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000867, RRID:AB_1078731
Product name
Anti-EIF5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000867
Antibody type
Polyclonal
Antigen
Eukaryotic translation initiation factor 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTV
IVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVK
NDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENP
ETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTF
ILKNPPENSD
Storage
-20C
Provider Type Product Number
- No reagents -