HPA020046

AKAP4 antibody from Atlas Antibodies
AKAP82, CT99, Fsc1, hAKAP82, HI, p82
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020046
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020046, RRID:AB_1844693
Product name
Anti-AKAP4
Provider product page
Atlas Antibodies - HPA020046
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EIIVIKDTEKKDQSKTEGSVCLFKQAPSDPVSVLN
WLLSDLQKYALGFQHALSPSTSTCKHKVGDTEGEY
HRASSENCYSVYADQVNIDYLMNRPQNLRLEMTAA
KNTNNNQSPSAPPAKPPSTQRAVISPDGECSIDD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -