HPA005949

AKAP4 antibody from MilliporeSigma / Merck KGaA
AKAP82, CT99, Fsc1, hAKAP82, HI, p82
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005949
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA005949, RRID:AB_1078120
Product name
Anti-AKAP4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA005949
Antibody type
Polyclonal
Antigen
A-kinase anchor protein 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SALKLIQYHLTQQTKGKDTCEEDCPGSTMGYMAQS
TQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKEN
QHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEG
ENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCT
SGMKQ
Storage
-20C
Provider Type Product Number
- No reagents -