HPA020046

AKAP4 antibody from Sigma-Aldrich
AKAP82, CT99, Fsc1, hAKAP82, HI, p82
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020046
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020046, RRID:AB_1844693
Product name
Anti-AKAP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020046
Antibody type
Polyclonal
Antigen
A-kinase anchor protein 4 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EIIVIKDTEKKDQSKTEGSVCLFKQAPSDPVSVLN
WLLSDLQKYALGFQHALSPSTSTCKHKVGDTEGEY
HRASSENCYSVYADQVNIDYLMNRPQNLRLEMTAA
KNTNNNQSPSAPPAKPPSTQRAVISPDGECSIDD
Storage
-20C
Provider Type Product Number
- No reagents -