HPA005647

DIAPH2 antibody from Sigma-Aldrich
DIA, DIA2, POF, POF2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005647
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005647, RRID:AB_1078657
Product name
Anti-DIAPH2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005647
Antibody type
Polyclonal
Antigen
Protein diaphanous homolog 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQ
IKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQV
AMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDM
NLNEEKKAPLRNKDFTTKREMVVQYISAT
Storage
-20C
Provider Type Product Number
- No reagents -