HPA019856

BAGE2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019856
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019856, RRID:AB_1845262
Product name
Anti-BAGE2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019856
Antibody type
Polyclonal
Antigen
B melanoma antigen 3 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FLALSAQLLQARLMKEESPVVSWRLEPEDGTALDV
HFVSTLEPLSNAVKRNVPRCIIILVLQEPTPFRIS
VTSSCFVQNTLTKLLKDRRKMQTVQCATARETS
Storage
-20C
Provider Type Product Number
- No reagents -