HPA001593

RPGR antibody from Sigma-Aldrich
COD1, CORDX1, CRD, RP15, RP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001593
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001593, RRID:AB_1079835
Product name
Anti-RPGR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001593
Antibody type
Polyclonal
Antigen
X-linked retinitis pigmentosa GTPase regulator recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EINDTCLSVATFLPYSSLTSGNVLQRTLSARMRRR
ERERSPDSFSMRRTLPPIEGTLGLSACFLPNSVFP
RCSERNLQESVLSEQDLMQPEEPDYLLDEMTKEAE
IDNSSTVESLGETTDILNMTHIMSLN
Storage
-20C
Provider Type Product Number
- No reagents -