HPA001478

ADGRG2 antibody from Sigma-Aldrich
EDDM6, GPR64, HE6, TM7LN2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001478
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001478, RRID:AB_1078923
Product name
Anti-GPR64 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001478
Antibody type
Polyclonal
Antigen
G-protein coupled receptor 64 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPTVSAPANVNTTSAPPVQTDIVNTSSISDLENQV
LQMEKALSLGSLEPNLAGEMINQVSRLLHSPPDML
APLAQRLLKVVDDIGLQLNFSNTTISLTSPSLALA
VIRVNASSFNTTTFVAQDPANLQVSLETQAPE
Storage
-20C
Provider Type Product Number
- No reagents -