Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28006 - Provider product page
- Provider
- Abnova Corporation
- Product name
- GPX2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant GPX2
- Antigen sequence
VLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQP
TFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFS
LMTDPKLIIWSPVRRSDVA- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251MG with GPX2 polyclonal antibody ( Cat # PAB28006 ) at 1-4 ug/ml dilution shows positivity in nucleus but not nucleoli & cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder with GPX2 polyclonal antibody ( Cat # PAB28006 ) shows strong nuclear and cytoplasmic positivity in urothelial cells at 1:200 - 1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)