HPA040620

antibody from Atlas Antibodies

Targeting: CEP68 KIAA0582

Antibody data

Submit

Validation data

Product number: HPA040620 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA040620, RRID:AB_10794144
Product name: Anti-CEP68
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GSPQLRTRDRGWPSPRPEREKRTSQSARRPTCTES RWKSEEEVESDDEYLALPARLTQVSSLVSYLGSIS TLVTLPT
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CEP68 protein structure - HPA040620 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human fallopian tube, kidney, liver and lymph node using Anti-CEP68 antibody HPA040620 (A) shows similar protein distribution across tissues to independent antibody HPA040493 (B).
Antibody #2 product nr: HPA040493
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube using Anti-CEP68 antibody HPA040620.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CEP68 antibody HPA040620.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-CEP68 antibody HPA040620.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-CEP68 antibody HPA040620.
Sample type: HUMAN