HPA019096

THOC1 antibody from Sigma-Aldrich
HPR1, P84
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019096
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019096, RRID:AB_1857979
Product name
Anti-THOC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019096
Antibody type
Polyclonal
Antigen
THO complex subunit 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTV
FNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAP
TTCSIPIDYNLYRKFWS
Storage
-20C
Provider Type Product Number
- No reagents -