HPA019096

THOC1 antibody from Atlas Antibodies
HPR1, P84
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019096
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019096, RRID:AB_1857979
Product name
Anti-THOC1
Provider product page
Atlas Antibodies - HPA019096
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTV
FNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAP
TTCSIPIDYNLYRKFWS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -