HPA023885

DMD antibody from Atlas Antibodies
BMD, DXS142, DXS164, DXS206, DXS230, DXS239, DXS268, DXS269, DXS270, DXS272, MRX85
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023885
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023885, RRID:AB_1847931
Product name
Anti-DMD
Provider product page
Atlas Antibodies - HPA023885
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQP
LEGLEKLYQEPRELPPEERAQNVTRLLRKQAEEVN
TEWEKLNLHSADWQRKIDETLERLQELQEATDELD
LKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALR
GEIAPLKENV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -