HPA023885

DMD antibody from Atlas Antibodies
BMD, DXS142, DXS164, DXS206, DXS230, DXS239, DXS268, DXS269, DXS270, DXS272, MRX85

Antibody data

Product number
HPA023885
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023885, RRID:AB_1847931
Product name
Anti-DMD
Provider product page
Atlas Antibodies - HPA023885
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQP
LEGLEKLYQEPRELPPEERAQNVTRLLRKQAEEVN
TEWEKLNLHSADWQRKIDETLERLQELQEATDELD
LKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALR
GEIAPLKENV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.