HPA002725

DMD antibody from Sigma-Aldrich
BMD, DXS142, DXS164, DXS206, DXS230, DXS239, DXS268, DXS269, DXS270, DXS272, MRX85
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002725
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002725, RRID:AB_1078714
Product name
Anti-DMD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002725
Antibody type
Polyclonal
Antigen
Dystrophin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVCQQSATQRLEHAFNIARYQLGIEKLLDPEDVDT
TYPDKKSILMYITSLFQVLPQQVSIEAIQEVEMLP
RPPKVTKEEHFQLHHQMHYSQQITVSLAQGYERTS
SPKPRFKSYAYTQAAYVTTSDPTRSPFPSQHLEAP
EDKSFGSS
Storage
-20C
Provider Type Product Number
- No reagents -