HPA001884

NUP62CL antibody from Sigma-Aldrich
FLJ20130
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001884
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001884, RRID:AB_1079512
Product name
Anti-NUP62CL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001884
Antibody type
Polyclonal
Antigen
Nucleoporin-62 C-terminal-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VATPVMTYGHLEGLINEWNLELEDQEKYFLLQATQ
VNAWDHTLIENGEMIRILHGEVNKVKLDQKRLEQE
LDFILSQQQELEFLLTYLEESTRDQSGLHYLQDAD
EEHVEISTRSAEF
Storage
-20C
Provider Type Product Number
- No reagents -