HPA003251

ZNF550 antibody from Sigma-Aldrich
MGC41917
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003251
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003251, RRID:AB_1080736
Product name
Anti-ZNF550 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003251
Antibody type
Polyclonal
Antigen
Zinc finger protein 550 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVHLLEHGQELWIVKRGLSHATCAGDRAQVHTREP
TTYPPVLSERAFLRGSLTLESSTSSDSRLGRARDE
EGLLEMQKGKVTPETDLHKETHLGKVSLEGEGLGT
DDGLHSRALQEWLSADVLHECDSQQPGK
Storage
-20C
Provider Type Product Number
- No reagents -