HPA004109

TSPAN6 antibody from Sigma-Aldrich
T245, TM4SF6, TSPAN-6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004109
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004109, RRID:AB_1080301
Product name
Anti-TSPAN6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004109
Antibody type
Polyclonal
Antigen
Tetraspanin-6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCC
GVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDA
DKVNNEG
Storage
-20C
Provider Type Product Number
- No reagents -