HPA002946

HCCS antibody from Atlas Antibodies
CCHL, MLS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002946
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002946, RRID:AB_1079041
Product name
Anti-HCCS
Provider product page
Atlas Antibodies - HPA002946
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQP
FALSTVREESSIPRADSEKKWVYPSEQMFWNAMLK
KGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILK
WEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWM
GYEL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -