HPA002946

HCCS antibody from Sigma-Aldrich
CCHL, MLS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002946
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002946, RRID:AB_1079041
Product name
Anti-HCCS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002946
Antibody type
Polyclonal
Antigen
Cytochrome c-type heme lyase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQP
FALSTVREESSIPRADSEKKWVYPSEQMFWNAMLK
KGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILK
WEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWM
GYEL
Storage
-20C
Provider Type Product Number
- No reagents -