Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB27898 - Provider product page

- Provider
- Abnova Corporation
- Product name
- C19orf40 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant C19orf40.
- Antigen sequence
VLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKN
PLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLL
QKFPSIQQLSNASIGELEQVVGQAVAQQ- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-2 OS with C19orf40 polyclonal antibody (Cat # PAB27898) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and vesicles.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human oral mucosa with C19orf40 polyclonal antibody (Cat # PAB27898) shows strong nuclear positivity in squamous epithelial cells at 1:500-1:1000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)