HPA017961

LSM14A antibody from Sigma-Aldrich
C19orf13, DKFZP434D1335, FAM61A, RAP55, RAP55A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017961
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017961, RRID:AB_1845610
Product name
Anti-LSM14A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017961
Antibody type
Polyclonal
Antigen
LSM14 protein homolog A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSS
LTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQL
SQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAV
GRRSPVS
Storage
-20C
Provider Type Product Number
- No reagents -