HPA004734

MEF2B antibody from Atlas Antibodies
RSRFR2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004734
Provider
Atlas Antibodies
Product name
Anti-MEF2B
Provider product page
Atlas Antibodies - HPA004734
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLLKYTEYSEPHESRTNTDILETLKRRGIGLDGPE
LEPDEGPEEPGEKFRRLAGEGGDPALPRPRLYPAA
PAMPSPDVVYGALPPPGCDPSGLGEALPAQSRPSP
FRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPT
E
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -