Antibody data

Product number
H00004207-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004207-M10, RRID:AB_530123
Product name
MEF2B monoclonal antibody (M10), clone 1D8
Provider product page
Abnova Corporation - H00004207-M10
Antibody type
Monoclonal
Antigen
MEF2B (AAH04449, 1 a.a. ~ 109 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reactivity
Human
Host
Mouse
Antigen sequence
MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRL
QEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYA
CSAVKNLVDSSVHFRSVEGLLKQAISIRDHMNASA
QGHR
Isotype
IgG
Vial size
100 µg
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -