H00004207-M08A

MEF2B antibody from Abnova Corporation
RSRFR2

Antibody data

Product number
H00004207-M08A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004207-M08A, RRID:AB_1204673
Product name
MEF2B monoclonal antibody (M08A), clone 1A3
Provider product page
Abnova Corporation - H00004207-M08A
Antibody type
Monoclonal
Antigen
MEF2B (AAH04449, 1 a.a. ~ 109 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reactivity
Human
Host
Mouse
Antigen sequence
MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRL
QEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYA
CSAVKNLVDSSVHFRSVEGLLKQAISIRDHMNASA
QGHR
Isotype
IgM
Vial size
200 uL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -