Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00729991-M10 - Provider product page

- Provider
- Abnova Corporation
- Product name
- MEF2BNB monoclonal antibody (M10), clone 1D8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant MEF2BNB.
- Antigen sequence
MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRL
QEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYA
CSAVKNLVDSSVHFRSVEGLLKQAISIRDHMNASA
QGHR- Isotype
- IgG
- Antibody clone number
- 1D8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MEF2BNB monoclonal antibody (M10), clone 1D8 Western Blot analysis of MEF2BNB expression in MCF-7 ( Cat # L046V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MEF2BNB is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to MEF2BNB on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol