HPA001603

FAM181A antibody from Sigma-Aldrich
C14orf152
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001603
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001603, RRID:AB_1078326
Product name
Anti-FAM181A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001603
Antibody type
Polyclonal
Antigen
Uncharacterized protein C14orf152
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NCKGLEPLGPETTLVSMSPRALAEKEPLKMPGVSL
VGRVNAWSCCPFQYHGQPIYPGPLGALPQSPVPSL
GLWRKSPAFPGELAHLCKDVDGLGQKVCRPVVLKP
IPTKPAVPPPIFNVFG
Storage
-20C
Provider Type Product Number
- No reagents -