HPA003656

PNPLA4 antibody from Sigma-Aldrich
DXS1283E, GS2, iPLA2eta
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003656
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003656, RRID:AB_1079033
Product name
Anti-PNPLA4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003656
Antibody type
Polyclonal
Antigen
Patatin-like phospholipase domain-containing protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESI
LPPSAHELAQNRLHVSITNAKTRENHLVSTFSSRE
DLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTN
ALPILPVGRTVTISPFSGRLDISPQDKGQLD
Storage
-20C
Provider Type Product Number
- No reagents -