Antibody data

Product number
ABIN502203
Provider
antibodies-online
Product name
anti-Glucagon (GCG) antibody
Provider product page
antibodies-online - ABIN502203
Antibody type
Polyclonal
Antigen
The immunogen for anti-GCG antibody: synthetic peptide directed towards the middle region of human GCG
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
VSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEE
LGRRH ADGSFSDEMN
Vial size
50 µg
Provider Type Product Number
- No reagents -