PAB29377

CDKL5 antibody from Abnova Corporation
CFAP247, EIEE2, STK9

Antibody data

Product number
PAB29377
Provider
Abnova Corporation
Product name
CDKL5 polyclonal antibody
Provider product page
Abnova Corporation - PAB29377
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant human CDKL5.
Antigen sequence
AARANSLQLLSPQPGEQLPPEMTVARSSVKETSRE
GTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYN
DPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLP
SESSSGTNHSKRQPAFDP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -