HPA002847

CDKL5 antibody from Atlas Antibodies
CFAP247, EIEE2, STK9
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002847
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002847, RRID:AB_1080107
Product name
Anti-CDKL5
Provider product page
Atlas Antibodies - HPA002847
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AARANSLQLLSPQPGEQLPPEMTVARSSVKETSRE
GTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYN
DPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLP
SESSSGTNHSKRQPAFDP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -