HPA002847

antibody from Atlas Antibodies

Targeting: CDKL5 CFAP247, EIEE2, STK9

Provider product page for HPA002847

Western blot

Immunocytochemistry

Immunohistochemistry

Antibody data

Antibody Data
Antigen structure
References [18]
Comments [0]
Validations [0]

Submit

Product number: HPA002847 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA002847, RRID:AB_1080107
Product name: Anti-CDKL5
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: AARANSLQLLSPQPGEQLPPEMTVARSSVKETSRE GTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYN DPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLP SESSSGTNHSKRQPAFDP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CDKL5 protein structure - HPA002847 shown in red.

Submitted references A new knockin mouse carrying the E364X patient mutation for CDKL5 deficiency disorder: neurological, behavioral and molecular profiling

Quadalti C, Sannia M, Humphreys N, Baldassarro V, Gurgone A, Ascolani M, Zanella L, Giardino L, Gross C, Croci S, Meloni I, Giustetto M, Renieri A, Lorenzini L, Calzà L
Heliyon 2024;10(21):e40165

Cell type-specific expression, regulation and compensation of CDKL5 activity in mouse brain.

Silvestre M, Dempster K, Mihaylov SR, Claxton S, Ultanir SK
Molecular psychiatry 2024 Jun;29(6):1844-1856

Enhanced hippocampal LTP but normal NMDA receptor and AMPA receptor function in a rat model of CDKL5 deficiency disorder.

Simões de Oliveira L, O'Leary HE, Nawaz S, Loureiro R, Davenport EC, Baxter P, Louros SR, Dando O, Perkins E, Peltier J, Trost M, Osterweil EK, Hardingham GE, Cousin MA, Chattarji S, Booker SA, Benke TA, Wyllie DJA, Kind PC
Molecular autism 2024 Jun 14;15(1):28

Discovery of a Potent and Selective CDKL5/GSK3 Chemical Probe That Is Neuroprotective

Ong H, Liang Y, Richardson W, Lowry E, Wells C, Chen X, Silvestre M, Dempster K, Silvaroli J, Smith J, Wichterle H, Pabla N, Ultanir S, Bullock A, Drewry D, Axtman A
ACS Chemical Neuroscience 2023;14(9):1672-1685

Epilepsy-linked kinase CDKL5 phosphorylates voltage-gated calcium channel Cav2.3, altering inactivation kinetics and neuronal excitability

Sampedro-Castañeda M, Baltussen L, Lopes A, Qiu Y, Sirvio L, Mihaylov S, Claxton S, Richardson J, Lignani G, Ultanir S
Nature Communications 2023;14(1)

Discovery and characterization of a specific inhibitor of serine-threonine kinase cyclin-dependent kinase-like 5 (CDKL5) demonstrates role in hippocampal CA1 physiology

Silvestre M, Castano A, Wells C, Sanderson J, Ferrer C, Ong H, Lang Y, Richardson W, Silvaroli J, Bashore F, Smith J, Genereux I, Dempster K, Drewry D, Pabla N, Bullock A, Benke T, Ultanir S, Axtman A
eLife 2023;12

Kontaxi C, Ivanova D, Davenport EC, Kind PC, Cousin MA
The Journal of neuroscience : the official journal of the Society for Neuroscience 2023 Mar 15;43(11):2002-2020

Ong H, Liang Y, Richardson W, Lowry E, Wells C, Chen X, Silvestre M, Dempster K, Silvaroli J, Smith J, Wichterle H, Pabla N, Ultanir S, Bullock A, Drewry D, Axtman A
2023

Loss of CDKL5 Causes Synaptic GABAergic Defects That Can Be Restored with the Neuroactive Steroid Pregnenolone-Methyl-Ether

De Rosa R, Valastro S, Cambria C, Barbiero I, Puricelli C, Tramarin M, Randi S, Bianchi M, Antonucci F, Kilstrup-Nielsen C
International Journal of Molecular Sciences 2022;24(1):68

Phenotypic characterization of Cdkl5-knockdown neurons establishes elongated cilia as a functional assay for CDKL5 Deficiency Disorder

Di Nardo A, Rühmkorf A, Award P, Brennecke A, Fagiolini M, Sahin M
Neuroscience Research 2022;176

Cyclin-dependent–like kinase 5 is required for pain signaling in human sensory neurons and mouse models

La Montanara P, Hervera A, Baltussen L, Hutson T, Palmisano I, De Virgiliis F, Kong G, Chadwick J, Gao Y, Bartus K, Majid Q, Gorgoraptis N, Wong K, Downs J, Pizzorusso T, Ultanir S, Leonard H, Yu H, Millar D, Istvan N, Mazarakis N, Di Giovanni S
Science Translational Medicine 2020;12(551)

Splicing Mutations Impairing CDKL5 Expression and Activity Can be Efficiently Rescued by U1snRNA-Based Therapy

Balestra D, Giorgio D, Bizzotto M, Fazzari M, Ben Zeev B, Pinotti M, Landsberger N, Frasca A
International Journal of Molecular Sciences 2019;20(17):4130

Aminoglycoside drugs induce efficient read-through ofCDKL5nonsense mutations, slightly restoring its kinase activity

Fazzari M, Frasca A, Bifari F, Landsberger N
RNA Biology 2019;16(10):1414-1423

Chemical genetic identification of CDKL 5 substrates reveals its role in neuronal microtubule dynamics

Baltussen L, Negraes P, Silvestre M, Claxton S, Moeskops M, Christodoulou E, Flynn H, Snijders A, Muotri A, Ultanir S
The EMBO Journal 2018;37(24)

CDKL5 localizes at the centrosome and midbody and is required for faithful cell division

Barbiero I, Valente D, Chandola C, Magi F, Bergo A, Monteonofrio L, Tramarin M, Fazzari M, Soddu S, Landsberger N, Rinaldo C, Kilstrup-Nielsen C
Scientific Reports 2017;7(1)

CDKL5 and Shootin1 Interact and Concur in Regulating Neuronal Polarization

Blum R, Nawaz M, Giarda E, Bedogni F, La Montanara P, Ricciardi S, Ciceri D, Alberio T, Landsberger N, Rusconi L, Kilstrup-Nielsen C
PLOS ONE 2016;11(2):e0148634

Synaptic Synthesis, Dephosphorylation, and Degradation

La Montanara P, Rusconi L, Locarno A, Forti L, Barbiero I, Tramarin M, Chandola C, Kilstrup-Nielsen C, Landsberger N
Journal of Biological Chemistry 2015;290(7):4512-4527

CDKL5 ensures excitatory synapse stability by reinforcing NGL-1–PSD95 interaction in the postsynaptic compartment and is impaired in patient iPSC-derived neurons

Ricciardi S, Ungaro F, Hambrock M, Rademacher N, Stefanelli G, Brambilla D, Sessa A, Magagnotti C, Bachi A, Giarda E, Verpelli C, Kilstrup-Nielsen C, Sala C, Kalscheuer V, Broccoli V
Nature Cell Biology 2012;14(9):911-923

No comments: Submit comment

No validations: Submit validation data