HPA002847

CDKL5 antibody from Sigma-Aldrich
CFAP247, EIEE2, STK9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002847
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002847, RRID:AB_1080107
Product name
Anti-CDKL5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002847
Antibody type
Polyclonal
Antigen
Cyclin-dependent kinase-like 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AARANSLQLLSPQPGEQLPPEMTVARSSVKETSRE
GTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYN
DPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLP
SESSSGTNHSKRQPAFDP
Storage
-20C
Provider Type Product Number
- No reagents -