Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1105205 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Amiloride-Sensitive Cation Channel 5, Intestinal (ACCN5) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the middle region of human ACCN5
- Description
- Purified using Protein A affinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNV
NQEAFTDNPALGFVD- Epitope
- Middle Region
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Molecular cloning, functional expression and chromosomal localization of an amiloride-sensitive Na(+) channel from human small intestine.
Schaefer L, Sakai H, Mattei M, Lazdunski M, Lingueglia E
FEBS letters 2000 Apr 14;471(2-3):205-10
FEBS letters 2000 Apr 14;471(2-3):205-10
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human Jurkat; WB Suggested Anti-ACCN5 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate; ACCN5 antibody - middle region (AP42578PU-N) in Human Jurkat cells using Western Blot