HPA029444

ASIC5 antibody from MilliporeSigma / Merck KGaA
ACCN5, HINAC, INAC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029444
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029444, RRID:AB_10611671
Product name
Anti-ACCN5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029444
Antibody type
Polyclonal
Antigen
amiloride-sensitive cation channel 5, intestinal recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVQYVEKMEFPAVTFCNLNRFQTDAVAKFGVIFFL
WHIVSKVLHLQEITANSTGSREATDFAASHQNFSI
VEFIRNKGFYLNNSTLLDCEFFGKPCSPKDFAHVF
TEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVN
QEAFTDNPAL
Storage
-20C
Provider Type Product Number
- No reagents -